UniProtKB/Swiss-Prot Q13285: Variant p.Pro129Leu

Steroidogenic factor 1
Gene: NR5A1
Chromosomal location: 9q33
Variant information

Variant position:  129
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Proline (P) to Leucine (L) at position 129 (P129L, p.Pro129Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Premature ovarian failure 7 (POF7) [MIM:612964]: An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol. {ECO:0000269|PubMed:19246354}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Involvement in disease:  Spermatogenic failure 8 (SPGF8) [MIM:613957]: An infertility disorder characterized by spermatogenesis failure and severe oligozoospermia. {ECO:0000269|PubMed:20887963}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SPGF8 and POF7; loss of activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  129
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  461
The length of the canonical sequence.

Location on the sequence:   KKAQIRANGFKLETGPPMGV  P PPPPPAPDYVLPPSLHGPEP
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEP

Mouse                         KKAQIRANGFKLETGPPMGVPPPPPPPPDYMLPPSLHAPEP

Rat                           KKAQIRANGFKLETGPPMGVPPPPPPPPDYMLPPSLHAPEP

Pig                           KKAQIRANGFKLETGPPMGVAPPPPPPPDYMLPPGLHAPEP

Bovine                        KKAQIRANGFKLETGPPVGVPPPPPPPPDYMLPHGLHASEP

Horse                         KKAQIRANGFKLETGPPMGVPPPPPPPPDYMLPPGLHVPEP

Baker's yeast                 --------------------------PVNLRIASRFYSD--

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 461 Steroidogenic factor 1
Cross 119 – 119 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Mutagenesis 119 – 119 K -> R. Loss of sumoylation; when associated with R-194.


Literature citations

Mutations in NR5A1 associated with ovarian insufficiency.
Lourenco D.; Brauner R.; Lin L.; De Perdigo A.; Weryha G.; Muresan M.; Boudjenah R.; Guerra-Junior G.; Maciel-Guerra A.T.; Achermann J.C.; McElreavey K.; Bashamboo A.;
N. Engl. J. Med. 360:1200-1210(2009)
Cited for: VARIANTS POF7 ALA-123; LEU-129; 231-LEU--LEU-233 DEL AND ASN-293; VARIANT ALA-146; CHARACTERIZATION OF VARIANTS POF7 ALA-123; LEU-129 AND ASN-293;

Human male infertility associated with mutations in NR5A1 encoding steroidogenic factor 1.
Bashamboo A.; Ferraz-de-Souza B.; Lourenco D.; Lin L.; Sebire N.J.; Montjean D.; Bignon-Topalovic J.; Mandelbaum J.; Siffroi J.P.; Christin-Maitre S.; Radhakrishna U.; Rouba H.; Ravel C.; Seeler J.; Achermann J.C.; McElreavey K.;
Am. J. Hum. Genet. 87:505-512(2010)
Cited for: VARIANTS SPGF8 ALA-123; LEU-129; LEU-131; CYS-191; SER-212 AND ASN-238; CHARACTERIZATION OF VARIANTS SPGF8 LEU-131; CYS-191; SER-212 AND ASN-238;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.