Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O95340: Variant p.Thr48Arg

Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Gene: PAPSS2
Feedback?
Variant information Variant position: help 48 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Threonine (T) to Arginine (R) at position 48 (T48R, p.Thr48Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In BCYM4; patient with premature pubarche and hyperandrogenism; decreased sulfate assimilation; increases ubiquitin-dependent protein instability. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 48 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 614 The length of the canonical sequence.
Location on the sequence: help NKRGQVVGTRGGFRGCTVWL T GLSGAGKTTISFALEEYLVS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         NKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVS

Mouse                         NKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVS

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 614 Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Region 1 – 215 Adenylyl-sulfate kinase
Beta strand 43 – 48



Literature citations
Inactivating PAPSS2 mutations in a patient with premature pubarche.
Noordam C.; Dhir V.; McNelis J.C.; Schlereth F.; Hanley N.A.; Krone N.; Smeitink J.A.; Smeets R.; Sweep F.C.; Claahsen-van der Grinten H.L.; Arlt W.;
N. Engl. J. Med. 360:2310-2318(2009)
Cited for: FUNCTION; CATALYTIC ACTIVITY; PATHWAY; VARIANT BCYM4 ARG-48; CHARACTERIZATION OF VARIANT BCYM4 ARG-48; TISSUE SPECIFICITY; PAPSS2 deficiency causes androgen excess via impaired DHEA sulfation - in vitro and in vivo studies in a family harboring two novel PAPSS2 mutations.
Oostdijk W.; Idkowiak J.; Mueller J.W.; House P.J.; Taylor A.E.; O'Reilly M.W.; Hughes B.A.; de Vries M.C.; Kant S.G.; Santen G.W.; Verkerk A.J.; Uitterlinden A.G.; Wit J.M.; Losekoot M.; Arlt W.;
J. Clin. Endocrinol. Metab. 2015:JC20143556-JC20143556(2015)
Cited for: VARIANT BCYM4 ASP-270; CHARACTERIZATION OF VARIANTS BCYM4 ARG-48 AND ASP-270; FUNCTION; CATALYTIC ACTIVITY; PATHWAY;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.