Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96CV9: Variant p.Glu478Gly

Optineurin
Gene: OPTN
Feedback?
Variant information Variant position: help 478 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Glycine (G) at position 478 (E478G, p.Glu478Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (E) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ALS12. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 478 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 577 The length of the canonical sequence.
Location on the sequence: help LETMTILRAQMEVYCSDFHA E RAAREKIHEEKEQLALQLAV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAV

Rhesus macaque                LETMTVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAV

Mouse                         LETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAI

Rat                           LETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAI

Pig                           LETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAV

Chicken                       LETMAVLRAQMEVYCSDFHAERAAREKIHEEKEQLAVQLAY

Xenopus laevis                KETIELLRAQVDVYCADFHAERSARENIHQEKEQLATRLAY

Zebrafish                     LETISVFQAQAEIYSSDFYAERAAREKIHEEKERLATQLEY

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 577 Optineurin
Region 411 – 577 Interaction with HD
Region 412 – 520 Interaction with MYO6
Coiled coil 239 – 508
Motif 474 – 479 UBAN
Mutagenesis 474 – 474 D -> N. No effect on retinal ganglion cell death, drastically decreased interaction with TFRC, loss of localization to recycling endosomes, loss of ubiquitin-binding; when associated with K-50.
Mutagenesis 474 – 474 D -> N. Significant reduction in ubiquitin binding, decreased interaction with TBK1, loss of localization to recycling endosomes, disruption of interaction with TFRC, loss of inhibition of IFNB activation in response to TLR3 or RIG-I signaling, no effect on retinal ganglion cell death.
Helix 470 – 502



Literature citations
Mutations of optineurin in amyotrophic lateral sclerosis.
Maruyama H.; Morino H.; Ito H.; Izumi Y.; Kato H.; Watanabe Y.; Kinoshita Y.; Kamada M.; Nodera H.; Suzuki H.; Komure O.; Matsuura S.; Kobatake K.; Morimoto N.; Abe K.; Suzuki N.; Aoki M.; Kawata A.; Hirai T.; Kato T.; Ogasawara K.; Hirano A.; Takumi T.; Kusaka H.; Hagiwara K.; Kaji R.; Kawakami H.;
Nature 465:223-226(2010)
Cited for: VARIANT ALS12 GLY-478; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.