Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q04656: Variant p.Asn1304Ser

Copper-transporting ATPase 1
Gene: ATP7A
Feedback?
Variant information Variant position: help 1304 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Serine (S) at position 1304 (N1304S, p.Asn1304Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In OHS; has approximately 33% residual copper transport; increased protein abundance; increased localization at the plasma membrane; does not cycle back to TGN under conditions of copper depletion; does not affect interaction with ATOX1; does not affect interaction with COMMD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1304 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1500 The length of the canonical sequence.
Location on the sequence: help AKVKQLQEEGKRVAMVGDGI N DSPALAMANVGIAIGTGTDV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDV

Mouse                         AKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDV

Rat                           AKVKQLQEEGKRVAMVGDGINDSPALAMASVGIAIGTGTDV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1500 Copper-transporting ATPase 1
Topological domain 1012 – 1356 Cytoplasmic
Binding site 1301 – 1301
Binding site 1305 – 1305
Alternative sequence 82 – 1499 Missing. In isoform 6.



Literature citations
The copper-transporting capacity of ATP7A mutants associated with Menkes disease is ameliorated by COMMD1 as a result of improved protein expression.
Vonk W.I.; de Bie P.; Wichers C.G.; van den Berghe P.V.; van der Plaats R.; Berger R.; Wijmenga C.; Klomp L.W.; van de Sluis B.;
Cell. Mol. Life Sci. 69:149-163(2012)
Cited for: INTERACTION WITH ATOX1 AND COMMD1; CHARACTERIZATION OF VARIANT OHS SER-1304; CHARACTERIZATION OF VARIANTS MNK ARG-873; ARG-1000 AND ASP-1362; Functional copper transport explains neurologic sparing in occipital horn syndrome.
Tang J.; Robertson S.; Lem K.E.; Godwin S.C.; Kaler S.G.;
Genet. Med. 8:711-718(2006)
Cited for: VARIANT OHS SER-1304; CHARACTERIZATION OF VARIANT OHS SER-1304;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.