UniProtKB/Swiss-Prot O95461: Variant p.Ser331Phe

Glycosyltransferase-like protein LARGE1
Gene: LARGE
Chromosomal location: 22q12.3
Variant information

Variant position:  331
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants have been found in patients and disease-association is reported in literature. However, this classification is not a definitive assessment of variant pathogenicity.
  • Polymorphism: No disease-association has been reported.
  • Unclassified: Variants have been found in patients but disease-association remains unclear.

Residue change:  From Serine (S) to Phenylalanine (F) at position 331 (S331F, p.Ser331Phe).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and polar (S) to large size and aromatic (F)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A6 (MDDGA6) [MIM:613154]: An autosomal recessive disorder characterized by congenital muscular dystrophy associated with cobblestone lissencephaly and other brain anomalies, eye malformations, profound mental retardation, and death usually in the first years of life. Included diseases are the more severe Walker-Warburg syndrome and the slightly less severe muscle-eye-brain disease. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MDDGA6.
Any additional useful information about the variant.



Sequence information

Variant position:  331
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  756
The length of the canonical sequence.

Location on the sequence:   KWEQMWRLTAERELMGMLST  S LADQDIFNAVIKQNPFLVYQ
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQ

Mouse                         KWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQ

Chicken                       KWEQMWRLTAERELMSMLSTSLADQDIFNAVIKQNPFLVYQ

Zebrafish                     KWEQMWRLTAERELMSMLSTSLADQDIFNAVIKQNPFLVHQ

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 756 Glycosyltransferase-like protein LARGE1
Topological domain 32 – 756 Lumenal


Literature citations

Brain involvement in muscular dystrophies with defective dystroglycan glycosylation.
Clement E.; Mercuri E.; Godfrey C.; Smith J.; Robb S.; Kinali M.; Straub V.; Bushby K.; Manzur A.; Talim B.; Cowan F.; Quinlivan R.; Klein A.; Longman C.; McWilliam R.; Topaloglu H.; Mein R.; Abbs S.; North K.; Barkovich A.J.; Rutherford M.; Muntoni F.;
Ann. Neurol. 64:573-582(2008)
Cited for: VARIANT MDDGA6 PHE-331;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.