UniProtKB/Swiss-Prot P00742: Variant p.Glu142Lys

Coagulation factor X
Gene: F10
Feedback?

Variant information Variant position:

142 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glutamate (E) to Lysine (K) at position 142 (E142K, p.Glu142Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and acidic (E) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In FA10D; uncertain significance; detected in patients carrying K-54 or P-374; slightly reduced activity. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs61753266 [ dbSNP | Ensembl ]

Sequence information Variant position:

142 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

488 The length of the canonical sequence.
Location on the sequence:

ELFTRKLCSLDNGDCDQFCH E EQNSVVCSCARGYTLADNGK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ELFTRKLCSLDNGDCDQFC---HEEQNSVVCSCARGYTLADNGK

Mouse                         ELFVRKLCRLDNGDCDQFC---REEQNSVVCSCASGYFLGN

Rat                           ELFVRKLCSLDNGDCDQFC---REEQNSVVCSCAKGYFLGN

Bovine                        EFSTREICSLDNGGCDQFC---REERSEVRCSCAHGYVLGD

Rabbit                        EPVTRKLCSLDNGGCDQFC---KEEENSVLCSCASGYTLGD

Chicken                       EFVIPKYCKINNGDCEQFCSIKKSVQKDVVCSCTSGYELAE

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	41 – 488	Coagulation factor X
Chain	41 – 179	Factor X light chain
Domain	125 – 165	EGF-like 2
Disulfide bond	136 – 149
Beta strand	137 – 143

Literature citations
Molecular defect (Gla+14TO: hereditary factor X deficiency (factor X 'Vorarlberg').
Watzke H.H.; Lechner K.; Roberts H.R.; Reddy S.V.; Welsch D.J.; Friedman P.; Mahr G.; Jagadeeswaran P.; Monroe D.M.; High K.A.;
J. Biol. Chem. 265:11982-11989(1990)
Cited for: VARIANTS FA10D LYS-54 AND LYS-142; CHARACTERIZATION OF VARIANT FA10D LYS-54; Molecular bases of CRM+ factor X deficiency: a frequent mutation (Ser334Pro) in the catalytic domain and a substitution (Glu102Lys) in the second EGF-like domain.
Marchetti G.; Castaman G.; Pinotti M.; Lunghi B.; Di Iasio M.G.; Ruggieri M.; Rodeghiero F.; Bernardi F.;
Br. J. Haematol. 90:910-915(1995)
Cited for: VARIANTS FA10D LYS-142 AND PRO-374; The impact of Glu102Lys on the factor X function in a patient with a doubly homozygous factor X deficiency (Gla14Lys and Glu102Lys).
Forberg E.; Huhmann I.; Jimenez-Boj E.; Watzke H.H.;
Thromb. Haemost. 83:234-238(2000)
Cited for: CHARACTERIZATION OF VARIANT FA10D LYS-142;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.