To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot O60603: Variant p.Arg571His

Toll-like receptor 2
Gene: TLR2
Chromosomal location: 4q32
Variant information

Variant position:  571
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Histidine (H) at position 571 (R571H, p.Arg571His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism:  Genetic variations in TLR2 are associated with susceptibility to leprosy [MIM:246300]. Leprosy is a chronic disease associated with depressed cellular (but not humoral) immunity, the bacterium requires a lower temperature than 37 degrees Celsius and thrives particularly in peripheral Schwann cells and macrophages. The Trp-677 polymorphism in the intracellular domain of TLR2 has a role in susceptibility to lepromatous leprosy. Wild-type TLR2 mediates CD14-enhanced Mycobacterium leprae-dependent activation of NFKB1, but TLR2 containing the Trp-677 polymorphism did not. The impaired function of the Trp-677 polymorphism provides a molecular mechanism for the poor cellular immune response associated with lepromatous leprosy.
Additional information on the polymorphism described.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  571
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  784
The length of the canonical sequence.

Location on the sequence:   LAKVLIDWPANYLCDSPSHV  R GQQVQDVRLSVSECHRTALV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALV

Gorilla                       LAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALV

                              LAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALV

Rhesus macaque                LAKVLVDWPANYLCDSPSHVRGQRVQDVRLSVSECHRAALV

Chimpanzee                    LAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALV

Mouse                         LAQILVDWPDSYLCDSPPRLHGHRLQDARPSVLECHQAALV

Bovine                        LGRVLVDWPDDYRCDSPSHVRGQRVQDARLSLSECHRAAVV

Goat                          LARVLVDWPDGYRCDAPSHVRGQRVQDARLSLSECHRAAVV

Sheep                         LARVLVDWPDGYRCDAPSHVRGQRVQDARLSLSECHRAAVV

Horse                         LDQILIDWPENYLCDSPSHVRGQRVQDTHLSVSECHRTALV

Drosophila                    -----------------------------FIITSCYPAITE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 21 – 784 Toll-like receptor 2
Topological domain 21 – 588 Extracellular
Domain 525 – 579 LRRCT


Literature citations

Functional characterization of naturally occurring genetic variants in the human TLR1-2-6 gene family.
Ben-Ali M.; Corre B.; Manry J.; Barreiro L.B.; Quach H.; Boniotto M.; Pellegrini S.; Quintana-Murci L.;
Hum. Mutat. 32:643-652(2011)
Cited for: VARIANTS ASP-89; ILE-411; HIS-571; HIS-631; ARG-636 AND GLN-753; CHARACTERIZATION OF VARIANTS ILE-411; HIS-631 AND GLN-753;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.