Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P36776: Variant p.Val911Ile

Lon protease homolog, mitochondrial
Gene: LONP1
Feedback?
Variant information Variant position: help 911 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Isoleucine (I) at position 911 (V911I, p.Val911Ile). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 911 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 959 The length of the canonical sequence.
Location on the sequence: help PVGGIKEKTIAAKRAGVTCI V LPAENKKDFYDLAAFITEGL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGL

Mouse                         PVGGIKEKTIAAKRAGVTCIILPAENRKDYSDLAPFITEGL

Rat                           PVGGIKEKTIAAKRAGVTCIILPAENRKDFSDLAPFITEGL

Bovine                        PVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGL

Caenorhabditis elegans        PVGGIREKVIAARRVGAKRVFLPNENRRDFDDLPEFMKSEL

Drosophila                    PVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGL

Baker's yeast                 RIGGLREKAVAAKRSGAKTIIFPKDNLNDWEELPDNVKEGL

Fission yeast                 RIGGLREKTVAAKLSGMKEILFPKSNLADWEQLPDYVKEGL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 68 – 959 Lon protease homolog, mitochondrial
Domain 759 – 949 Lon proteolytic
Active site 898 – 898
Mutagenesis 893 – 893 G -> A. Has low basal, but normal stimulated ATPase activity, and retains peptidase activity.
Mutagenesis 893 – 893 G -> P. Has normal basal, but low stimulated ATPase activity, and abolishes peptidase activity.
Mutagenesis 894 – 894 G -> AS. Enhances the basal, but not the stimulated ATPase activity, and retains peptidase activity.
Mutagenesis 894 – 894 G -> P. Enhances the basal, but not the stimulated ATPase activity, and abolishes peptidase activity.
Beta strand 909 – 913



Literature citations
Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
Wang W.; Shen P.; Thiyagarajan S.; Lin S.; Palm C.; Horvath R.; Klopstock T.; Cutler D.; Pique L.; Schrijver I.; Davis R.W.; Mindrinos M.; Speed T.P.; Scharfe C.;
Nucleic Acids Res. 39:44-58(2011)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ILE-911; Cloning and sequence analysis of cDNA for a human homolog of eubacterial ATP-dependent Lon proteases.
Amerik A.Y.; Petukhova G.V.; Grigorenko V.G.; Lykov I.P.; Yarovoi S.V.; Lipkin V.M.; Gorbalenya A.E.;
FEBS Lett. 340:25-28(1994)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3-959 (ISOFORM 1); VARIANT ILE-911;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.