Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12879: Variant p.Arg920Lys

Glutamate receptor ionotropic, NMDA 2A
Gene: GRIN2A
Feedback?
Variant information Variant position: help 920 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Lysine (K) at position 920 (R920K, p.Arg920Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are large size and basic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Found in a cutaneous malignant melanoma sample; somatic mutation. Any additional useful information about the variant.


Sequence information Variant position: help 920 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1464 The length of the canonical sequence.
Location on the sequence: help SAKNISSMSNMNSSRMDSPK R AADFIQRGSLIMDMVSDKGN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SAKNISSMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGN

Chimpanzee                    SAKNISNMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGN

Mouse                         SAKNISNMSNMNSSRMDSPKRAADFIQRGSLIVDMVSDKGN

Rat                           SAKNISNMSNMNSSRMDSPKRATDFIQRGSLIVDMVSDKGN

Xenopus laevis                ASKNIANLSNLNQSQCNSPKRTSDYIQRNSLLTDMVLDKGN

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 1464 Glutamate receptor ionotropic, NMDA 2A
Topological domain 836 – 1464 Cytoplasmic
Modified residue 929 – 929 Phosphoserine



Literature citations
Exome sequencing identifies GRIN2A as frequently mutated in melanoma.
Wei X.; Walia V.; Lin J.C.; Teer J.K.; Prickett T.D.; Gartner J.; Davis S.; Stemke-Hale K.; Davies M.A.; Gershenwald J.E.; Robinson W.; Robinson S.; Rosenberg S.A.; Samuels Y.;
Nat. Genet. 43:442-446(2011)
Cited for: PROBABLE INVOLVEMENT IN MELANOMA; VARIANTS LEU-57; ILE-183; ASN-252; PHE-278; LYS-371; LYS-373; GLU-449; SER-459; ARG-595; PHE-598; ILE-653; GLU-712; TRP-740; GLU-889; LYS-920; PHE-929; LYS-962; LYS-1073; LEU-1074; ASN-1153; LYS-1175; GLY-1276; LYS-1285; TRP-1318; LEU-1366; ASN-1421; LEU-1425; LYS-1426 AND CYS-1462;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.