To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot Q8IY92: Variant p.Ala505Thr

Structure-specific endonuclease subunit SLX4
Gene: SLX4
Chromosomal location: 16p13.3
Variant information

Variant position:  505
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Threonine (T) at position 505 (A505T, p.Ala505Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page



Sequence information

Variant position:  505
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1834
The length of the canonical sequence.

Location on the sequence:   DRVALLLSEEVELSSTPPLP  A SRILKEGWERAGQCPPPPER
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPER

Mouse                         DRVAQLLSEEAELSCTPPLLASKISKEELEPAGWRARLPEG

Drosophila                    DLESYYVTDLFEVSRTP---AHHLLKN-WAAIQGRDFSPER

Baker's yeast                 KNITDFNINNYERSRTASL----------------------

Fission yeast                 DNESDIL----------------------------------

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1834 Structure-specific endonuclease subunit SLX4
Region 1 – 669 Interaction with SLX4IP, ERCC4 and MSH2


Literature citations

Analysis of the novel Fanconi anemia gene SLX4/FANCP in familial breast cancer cases.
Bakker J.L.; van Mil S.E.; Crossan G.; Sabbaghian N.; De Leeneer K.; Poppe B.; Adank M.; Gille H.; Verheul H.; Meijers-Heijboer H.; de Winter J.P.; Claes K.; Tischkowitz M.; Waisfisz Q.;
Hum. Mutat. 34:70-73(2013)
Cited for: VARIANTS PHE-38; TRP-141; ALA-197; CYS-204; GLN-237; ARG-284; THR-378; THR-385; VAL-386; VAL-424; LYS-457; GLU-458; THR-505; ASN-506; MET-568; PRO-579; SER-671; LYS-787; VAL-870; GLY-894; LEU-929; GLN-942; MET-952; LEU-975; LYS-1007; TRP-1060; LEU-1122; TYR-1123; VAL-1221; PHE-1271; VAL-1286; GLY-1287; GLY-1342; PHE-1421; SER-1476; TRP-1550; VAL-1694; CYS-1814 AND SER-1834; CHARACTERIZATION OF VARIANTS THR-378; LYS-787; TRP-1550 AND CYS-1814; NO ASSOCIATION WITH BREAST CANCER;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.