UniProtKB/Swiss-Prot P01148 : Variant p.Arg31Cys
Progonadoliberin-1
Gene: GNRH1
Feedback ?
Variant information
Variant position:
31
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
US
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Arginine (R) to Cysteine (C) at position 31 (R31C, p.Arg31Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Change from large size and basic (R) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
-3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Variant description:
In HH12; uncertain significance; the patient also carries mutations in PROKR2 and FGFR1.
Any additional useful information about the variant.
Sequence information
Variant position:
31
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
92
The length of the canonical sequence.
Location on the sequence:
LILLTWCVEGCSSQHWSYGL
R PGGKRDAENLIDSFQEIVKE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human LILLTWCVE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GCSSQH--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------WSYG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LR PGGKRDAE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NLIDSFQEIVKE-
Mouse ILLLTVCLE--------------------------------
Rat VVLLTVCLE--------------------------------
Pig LLLLTLCVV--------------------------------
Chicken VLLFTASVA--------------------------------
Xenopus laevis FLVLLFSAH--------------------------------
Caenorhabditis elegans LILLVVCLVYALQSGSGTISEFSSDVLFSRAKYSGVPVHHS
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
24 – 92
Progonadoliberin-1
Peptide
24 – 33
Gonadoliberin-1
Site
26 – 26
Appears to be essential for biological activity
Site
30 – 31
Cleavage; by ACE
Modified residue
24 – 24
Pyrrolidone carboxylic acid
Modified residue
33 – 33
Glycine amide
Literature citations
Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
Miraoui H.; Dwyer A.A.; Sykiotis G.P.; Plummer L.; Chung W.; Feng B.; Beenken A.; Clarke J.; Pers T.H.; Dworzynski P.; Keefe K.; Niedziela M.; Raivio T.; Crowley W.F. Jr.; Seminara S.B.; Quinton R.; Hughes V.A.; Kumanov P.; Young J.; Yialamas M.A.; Hall J.E.; Van Vliet G.; Chanoine J.P.; Rubenstein J.; Mohammadi M.; Tsai P.S.; Sidis Y.; Lage K.; Pitteloud N.;
Am. J. Hum. Genet. 92:725-743(2013)
Cited for: VARIANT HH12 CYS-31;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.