Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P01031: Variant p.Arg885His

Complement C5
Gene: C5
Feedback?
Variant information Variant position: help 885 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Histidine (H) at position 885 (R885H, p.Arg885His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help C5 variants are responsible for poor response to eculizumab [MIM:615749]. Eculizumab is a monoclonal antibody highly effective in reducing intravascular hemolysis in patients with paroxysmal nocturnal hemoglobinuria. It specifically binds to the terminal complement protein C5, inhibits its cleavage into C5a and C5b, and prevents the formations of the cytolytic complement pore (PubMed:24521109). Additional information on the polymorphism described.
Variant description: help Risk factor for poor response to eculizumab in PNH patients. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 885 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1676 The length of the canonical sequence.
Location on the sequence: help ICTSESPVIDHQGTKSSKCV R QKVEGSSSHLVTFTVLPLEI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEI

Mouse                         ICTSGSSAASLHTSRPSRCVFQRIEGSSSHLVTFTLLPLEI

Rat                           ICTPGSSAASPQTSRSSRCVRQRIEGSSSHLVTFSLLPLEI

Pig                           -----------------------------------------

Bovine                        -----------------------------------------

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 678 – 1676 Complement C5 alpha chain
Chain 752 – 1676 Complement C5b
Disulfide bond 866 – 1527



Literature citations
Genetic variants in C5 and poor response to eculizumab.
Nishimura J.; Yamamoto M.; Hayashi S.; Ohyashiki K.; Ando K.; Brodsky A.L.; Noji H.; Kitamura K.; Eto T.; Takahashi T.; Masuko M.; Matsumoto T.; Wano Y.; Shichishima T.; Shibayama H.; Hase M.; Li L.; Johnson K.; Lazarowski A.; Tamburini P.; Inazawa J.; Kinoshita T.; Kanakura Y.;
N. Engl. J. Med. 370:632-639(2014)
Cited for: VARIANTS CYS-885 AND HIS-885; INVOLVEMENT IN POOR RESPONSE TO ECULIZUMAB;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.