Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P05160: Variant p.Pro448Ser

Coagulation factor XIII B chain
Gene: F13B
Feedback?
Variant information Variant position: help 448 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Serine (S) at position 448 (P448S, p.Pro448Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In FA13BD; impaired interaction with F13A1; impaired structure. Any additional useful information about the variant.


Sequence information Variant position: help 448 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 661 The length of the canonical sequence.
Location on the sequence: help YYLLRGSKISRCEQGKWSSP P VCLEPCTVNVDYMNRNNIEM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         YYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEM

Mouse                         YYLLKGSETSRCEQGAWSSPPVCLEPCTIDVDHMNRNNIQL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 21 – 661 Coagulation factor XIII B chain
Domain 394 – 452 Sushi 7
Disulfide bond 425 – 450



Literature citations
Mutations affecting disulphide bonds contribute to a fairly common prevalence of F13B gene defects: results of a genetic study in 14 families with factor XIII B deficiency.
Ivaskevicius V.; Biswas A.; Loreth R.; Schroeder V.; Ohlenforst S.; Rott H.; Krause M.; Kohler H.P.; Scharrer I.; Oldenburg J.;
Haemophilia 16:675-682(2010)
Cited for: VARIANTS FA13BD ARG-25; ASN-101; PHE-136; ILE-237; PHE-336; GLU-421 AND SER-448; Structural and functional influences of coagulation factor XIII subunit B heterozygous missense mutants.
Thomas A.; Biswas A.; Ivaskevicius V.; Oldenburg J.;
Mol. Genet. Genomic Med. 3:258-271(2015)
Cited for: CHARACTERIZATION OF VARIANTS FA13BD ARG-25; ASN-101; PHE-136; ILE-237; PHE-336; GLU-421 AND SER-448; SUBCELLULAR LOCATION; SUBUNIT; INTERACTION WITH F13A1;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.