UniProtKB/Swiss-Prot Q9NVH6: Variant p.Asp244His

Trimethyllysine dioxygenase, mitochondrial
Gene: TMLHE
Chromosomal location: Xq28
Variant information

Variant position:  244
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Aspartate (D) to Histidine (H) at position 244 (D244H, p.Asp244His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Autism, X-linked 6 (AUTSX6) [MIM:300872]: A form of autism, a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. AUTSX6 patients may respond favorably to carnitine supplementation. {ECO:0000269|PubMed:21865298, ECO:0000269|PubMed:23092983}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In AUTSX6; loss of function.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  244
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  421
The length of the canonical sequence.

Location on the sequence:   TSDFSRGDTAYTKLALDRHT  D TTYFQEPCGIQVFHCLKHEG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEG

Mouse                         TSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEG

Rat                           TSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEG

Bovine                        TSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEG

Chicken                       TSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 16 – 421 Trimethyllysine dioxygenase, mitochondrial
Metal binding 242 – 242 Iron; catalytic
Metal binding 244 – 244 Iron; catalytic
Modified residue 236 – 236 N6-acetyllysine


Literature citations

Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
Nava C.; Lamari F.; Heron D.; Mignot C.; Rastetter A.; Keren B.; Cohen D.; Faudet A.; Bouteiller D.; Gilleron M.; Jacquette A.; Whalen S.; Afenjar A.; Perisse D.; Laurent C.; Dupuits C.; Gautier C.; Gerard M.; Huguet G.; Caillet S.; Leheup B.; Leboyer M.; Gillberg C.; Delorme R.; Bourgeron T.; Brice A.; Depienne C.;
Transl. Psychiatry 2:E179-E179(2012)
Cited for: VARIANTS AUTSX6 HIS-244 AND ASP-369; CHARACTERIZATION OF VARIANTS AUTSX6 HIS-244 AND ASP-369; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.