To improve security and privacy, we are moving our web pages and services from HTTP to HTTPS.
To give users of web services time to transition to HTTPS, we will support separate HTTP and HTTPS services until the end of 2017.
From January 2018 most HTTP traffic will be automatically redirected to HTTPS. [more...]
View this page in https

UniProtKB/Swiss-Prot P55201: Variant p.Pro370Ser

Peregrin
Gene: BRPF1
Chromosomal location: 3p26
Variant information

Variant position:  370
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Proline (P) to Serine (S) at position 370 (P370S, p.Pro370Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (P) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Intellectual developmental disorder with dysmorphic facies and ptosis (IDDDFP) [MIM:617333]: An autosomal dominant neurodevelopmental disorder characterized by delayed psychomotor development, intellectual disability, delayed language, and facial dysmorphisms, most notably ptosis. Additional features may include poor growth, hypotonia, and seizures. {ECO:0000269|PubMed:27939639, ECO:0000269|PubMed:27939640}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In IDDDFP; decreased histone H3-K23 acetylation; changed cytoplasmic localization; no effect on expression and assembly of the MOZ/MORF complex.
Any additional useful information about the variant.



Sequence information

Variant position:  370
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1214
The length of the canonical sequence.

Location on the sequence:   HVVCALWIPEVCFANTVFLE  P IDSIEHIPPARWKLTCYICK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         HVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICK

Mouse                         HVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1214 Peregrin
Beta strand 369 – 372


Literature citations

Mutations in the chromatin regulator gene BRPF1 cause syndromic intellectual disability and deficient histone acetylation.
Yan K.; Rousseau J.; Littlejohn R.O.; Kiss C.; Lehman A.; Rosenfeld J.A.; Stumpel C.T.; Stegmann A.P.; Robak L.; Scaglia F.; Nguyen T.T.; Fu H.; Ajeawung N.F.; Camurri M.V.; Li L.; Gardham A.; Panis B.; Almannai M.; Sacoto M.J.; Baskin B.; Ruivenkamp C.; Xia F.; Bi W.; Cho M.T.; Potjer T.P.; Santen G.W.; Parker M.J.; Canham N.; McKinnon M.; Potocki L.; MacKenzie J.J.; Roeder E.R.; Campeau P.M.; Yang X.J.;
Am. J. Hum. Genet. 100:91-104(2017)
Cited for: INVOLVEMENT IN IDDDFP; VARIANTS IDDDFP SER-370; 455-ARG--ASP-1214 DEL; 833-GLY--ASP-1214 DEL AND 1100-PRO--ASP-1214 DEL; CHARACTERIZATION OF VARIANTS IDDDFP SER-370; 455-ARG--ASP-1214 DEL; 833-GLY--ASP-1214 DEL AND 1100-PRO--ASP-1214 DEL; FUNCTION; SUBUNIT; INTERACTION WITH KAT7; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.