Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8IZD2: Variant p.Val140Ile

Inactive histone-lysine N-methyltransferase 2E
Gene: KMT2E
Feedback?
Variant information Variant position: help 140 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Valine (V) to Isoleucine (I) at position 140 (V140I, p.Val140Ile). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In ODLURO. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 140 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1858 The length of the canonical sequence.
Location on the sequence: help RCICGFTHDDGYMICCDKCS V WQHIDCMGIDRQHIPDTYLC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         RCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLC

Mouse                         RCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLC
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1858 Inactive histone-lysine N-methyltransferase 2E
Zinc finger 118 – 166 PHD-type
Binding site 121 – 121
Binding site 123 – 123
Binding site 135 – 135
Binding site 138 – 138
Binding site 143 – 143
Binding site 146 – 146
Binding site 160 – 160
Mutagenesis 125 – 125 F -> A. No effect on binding to tri-methylated 'Lys-4' of histone H3 (H3K4me3).
Mutagenesis 128 – 128 D -> K. Severe reduction in the binding to tri-methylated 'Lys-4' of histone H3 (H3K4me3).
Mutagenesis 131 – 131 Y -> AK. Severe reduction in the binding to tri-methylated 'Lys-4' of histone H3 (H3K4me3).
Mutagenesis 141 – 141 W -> A. Loss of binding to tri-methylated 'Lys-4' of histone H3 (H3K4me3).



Literature citations
Heterozygous variants in KMT2E cause a spectrum of neurodevelopmental disorders and epilepsy.
O'Donnell-Luria A.H.; Pais L.S.; Faundes V.; Wood J.C.; Sveden A.; Luria V.; Abou Jamra R.; Accogli A.; Amburgey K.; Anderlid B.M.; Azzarello-Burri S.; Basinger A.A.; Bianchini C.; Bird L.M.; Buchert R.; Carre W.; Ceulemans S.; Charles P.; Cox H.; Culliton L.; Curro A.; Demurger F.; Dowling J.J.; Duban-Bedu B.; Dubourg C.; Eiset S.E.; Escobar L.F.; Ferrarini A.; Haack T.B.; Hashim M.; Heide S.; Helbig K.L.; Helbig I.; Heredia R.; Heron D.; Isidor B.; Jonasson A.R.; Joset P.; Keren B.; Kok F.; Kroes H.Y.; Lavillaureix A.; Lu X.; Maas S.M.; Maegawa G.H.B.; Marcelis C.L.M.; Mark P.R.; Masruha M.R.; McLaughlin H.M.; McWalter K.; Melchinger E.U.; Mercimek-Andrews S.; Nava C.; Pendziwiat M.; Person R.; Ramelli G.P.; Ramos L.L.P.; Rauch A.; Reavey C.; Renieri A.; Riess A.; Sanchez-Valle A.; Sattar S.; Saunders C.; Schwarz N.; Smol T.; Srour M.; Steindl K.; Syrbe S.; Taylor J.C.; Telegrafi A.; Thiffault I.; Trauner D.A.; van der Linden H. Jr.; van Koningsbruggen S.; Villard L.; Vogel I.; Vogt J.; Weber Y.G.; Wentzensen I.M.; Widjaja E.; Zak J.; Baxter S.; Banka S.; Rodan L.H.;
Am. J. Hum. Genet. 104:1210-1222(2019)
Cited for: INVOLVEMENT IN ODLURO; VARIANTS ODLURO ILE-140; 151-ARG--HIS-1858 DEL; HIS-284; 754-SER--HIS-1858 DEL; 818-ARG--HIS-1858 DEL; 874-ARG--HIS-1858 DEL; VAL-907; 1024-GLN--HIS-1858 DEL; 1185-SER--HIS-1858 DEL; 1224-TYR--HIS-1858 DEL AND SER-1376; VARIANT LEU-1376;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.