Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NS62: Variant p.Pro639Leu

Thrombospondin type-1 domain-containing protein 1
Gene: THSD1
Feedback?
Variant information Variant position: help 639 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Leucine (L) at position 639 (P639L, p.Pro639Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ANIB12; decreased function in endothelial cell-matrix adhesion; decreased interaction with TLN1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 639 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 852 The length of the canonical sequence.
Location on the sequence: help SPSQTLIRKSQARHVGSRGG P SERSHARNAHFRRTASFHEA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SPSQTLIRKSQARHVGSRGGPSERSHARNAHFRRTASFHEA

Mouse                         SPSQTLIQKSQIRSTGGRDGSSERCHSRSSLFRRTASFHET

Bovine                        SPSQTLLRKSQV-----------RSHSRGSHFRRTASFHEA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 25 – 852 Thrombospondin type-1 domain-containing protein 1
Topological domain 435 – 852 Cytoplasmic
Region 624 – 799 Disordered
Compositional bias 637 – 665 Basic and acidic residues
Alternative sequence 430 – 852 Missing. In isoform 3.



Literature citations
THSD1 (thrombospondin type 1 domain containing protein 1) mutation in the pathogenesis of intracranial aneurysm and subarachnoid emorrhage.
Santiago-Sim T.; Fang X.; Hennessy M.L.; Nalbach S.V.; DePalma S.R.; Lee M.S.; Greenway S.C.; McDonough B.; Hergenroeder G.W.; Patek K.J.; Colosimo S.M.; Qualmann K.J.; Hagan J.P.; Milewicz D.M.; MacRae C.A.; Dymecki S.M.; Seidman C.E.; Seidman J.G.; Kim D.H.;
Stroke 47:3005-3013(2016)
Cited for: INVOLVEMENT IN ANIB12; VARIANTS ANIB12 PHE-5; 450-ARG--ILE-852 DEL; TRP-460; GLY-466; GLU-600; LEU-639; ILE-653 AND PRO-775; CHARACTERIZATION OF VARIANTS ANIB12 PHE-5; 450-ARG--ILE-852 DEL; TRP-460; GLY-466; GLU-600; LEU-639; ILE-653 AND PRO-775; FUNCTION; INTERACTION WITH TLN1; The Intracranial Aneurysm Gene THSD1 Connects Endosome Dynamics to Nascent Focal Adhesion Assembly.
Rui Y.N.; Xu Z.; Fang X.; Menezes M.R.; Balzeau J.; Niu A.; Hagan J.P.; Kim D.H.;
Cell. Physiol. Biochem. 43:2200-2211(2017)
Cited for: INVOLVEMENT IN ANIB12; CHARACTERIZATION OF VARIANTS ANIB12 TRP-460; GLY-466; GLU-600; LEU-639; ILE-653 AND PRO-775; FUNCTION; SUBCELLULAR LOCATION; SUBUNIT; INTERACTION WITH TLN1;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.