ABCD_AF106 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P22646 Mus musculus (Mouse) |
| Target name | CD3e, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain |
| Epitope | Sequence:DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVSEY |
| Antibody information | |
| Antibody name | anti-CD3ϵ-2C11 |
| Antibody synonyms | 145-2C11 |
| Applications | ELISA, Flow cytometry, Immunofluorescence, Immunohistochemistry, X-ray crystallography |
| Cross-references | PDB: 3R08 Cellosaurus: CVCL_7234 |
| Publications | Patent: US20160130347 PMID: 8929708 PMID: 22262845 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |