Expasy logo

ABCD

ABCD_AK429 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O35681 Mus musculus (Mouse)
UniProt: P40748 Rattus norvegicus (Rat)
UniProt: Q9BQG1 Homo sapiens (Human)
Target name Syt3, SytIII, Synaptotagmin-3, Synaptotagmin III
Epitope Cytoplasmic C2B domain
Sequence:
AGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVF
DVAPESVENVGLSIAVVDYDCIGHNEVIGVCR
Antibody information
Antibody name N278/19R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N278_19.pdf
Addgene: 114476
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).