Expasy logo

ABCD

ABCD_AK434 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q920N7 Mus musculus (Mouse)
UniProt: P97610 Rattus norvegicus (Rat)
Target name Syt12, SytXII, Srg1, Sytr1, Synaptotagmin-12, Synaptotagmin XII, Synaptotagmin-related gene 1 protein, Srg1
Epitope Cytoplasmic C2A domain
Sequence:
TLHVAVLQGKDLLEREEATFESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSVPLDP
TALEEKSLRFSVFGIDEDERNVSTGVVE
Antibody information
Antibody name N277/7R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N277_7.pdf
Addgene: 114482
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).