Expasy logo

ABCD

ABCD_AK437 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9BZ95 Homo sapiens (Human)
UniProt: Q6P2L6 Mus musculus (Mouse)
UniProt: D3ZK47 Rattus norvegicus (Rat)
Target name NSD3, WHSC1L1, DC28, Histone-lysine N-methyltransferase NSD3, Nuclear SET domain-containing protein 3, Protein whistle, WHSC1-like 1 isoform 9 with methyltransferase activity to lysine, Wolf-Hirschhorn syndrome candidate 1-like protein 1, WHSC1-like protein 1
Epitope Sequence:
QLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYPATTEDLPPLTNGYPSSISVY
ETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTRPHEILEKPSPPQPPPPPSVP
QTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQASEHTKSKHESRKEKRKKS
NKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPREEPVLKEEAPVQ
Antibody information
Antibody name N348/82R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N348_82.pdf
Addgene: 114485
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.