Expasy logo

ABCD

ABCD_AK440 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P35462 Homo sapiens (Human)
Target name DRD3, D(3) dopamine receptor, Dopamine D3 receptor
Epitope Third intracellular loop
Sequence:
ILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKT
RNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPL
Antibody information
Antibody name N331/19R
Applications Immunofluorescence
Cross-references NeuroMab: N331_19.pdf
Addgene: 114488
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).