ABCD_AK443 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q7TSF2 Rattus norvegicus (Rat) UniProt: Q8BFU8 Mus musculus (Mouse) |
| Target name | Slc17a8, Vglut3, Vesicular glutamate transporter 3, VGluT3, Solute carrier family 17 member 8 |
| Epitope | Cytoplasmic C-terminal domain Sequence:MSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS |
| Antibody information | |
| Antibody name | N34/34.2R |
| Applications | Immunofluorescence, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N34_34.pdf Addgene: 114494 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |