ABCD_AK444 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: D3Z120 Mus musculus (Mouse) UniProt: E0CZH3 Mus musculus (Mouse) |
| Target name | Foxi3, Forkhead box I3 |
| Epitope | Sequence:MLSPKCRGQPRSPKAAAALHQPSVADMALYCGDNFVYSQPAAAPGAPPTSRAPYGLSDYAAPPAAAANPYLWLNGPGVGGPASAASYLGAPPPPPGAAPGPFLQPPAAPGTFAGAQRGFAQPSASAP |
| Antibody information | |
| Antibody name | N359/28R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N359_28.pdf Addgene: 114495 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |