Expasy logo

ABCD

ABCD_AK447 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9Z2I7 Rattus norvegicus (Rat)
UniProt: Q8BFT9 Mus musculus (Mouse)
Target name Svop, Synaptic vesicle 2-related protein, SV2-related protein
Epitope Cytoplasmic N-terminal domain
Sequence:
MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEF
ANPTDDTFMVEDAVEAIGFGRFQWK
Antibody information
Antibody name N356/23R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N356_23.pdf
Addgene: 114499
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).