Expasy logo

ABCD

ABCD_AK448 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JI12 Rattus norvegicus (Rat)
UniProt: Q8BLE7 Mus musculus (Mouse)
Target name Slc17a6, Dnpi, Vglut2, Vesicular glutamate transporter 2, VGluT2, Differentiation-associated BNPI, Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, Solute carrier family 17 member 6
Epitope Cytoplasmic C-terminal domain
Sequence:
EKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEK
KEEFVQESAQDAYSYKDRDDYS
Antibody information
Antibody name N29/29R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N29_29.pdf
Addgene: 114501
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).