Expasy logo

ABCD

ABCD_AK455 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P25122 Rattus norvegicus (Rat)
UniProt: P15388 Mus musculus (Mouse)
Target name Kcnc1, Potassium voltage-gated channel subfamily C member 1, NGK2, RAW2, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4
Epitope Cytoplasmic C-terminal domain
Sequence:
NNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEIL
EINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTRERYGPCFLLSTGEYAC
PPGGGMRKDLCKESPVIAKYMPTEAVRVT
Antibody information
Antibody name N16B/8R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N16B_8.pdf
Addgene: 114511
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).