Expasy logo

ABCD

ABCD_AK456 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JKB0 Rattus norvegicus (Rat)
UniProt: O88704 Mus musculus (Mouse)
UniProt: Q9P1Z3 Homo sapiens (Human)
Target name HCN3, Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1, Brain cyclic nucleotide-gated channel 1, BCNG-1, Hyperpolarization-activated cation channel 2, HAC-2, Bcng1, Hac2
Epitope Cytoplasmic C-terminal domain
Sequence:
TPGSSTPKNEVHKSTQALHNTHLTREVRPLSASQPSLPHEVSTMISRPHPTVGESLASIP
QPVATVHSTGLQAGSRSTVPQRVTLFRQMSSGAIPPNRGVPPAPPPPAAVQRESPSVLNK
DPDAEKPRFASNL
Antibody information
Antibody name N70/28R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N70_28.pdf
Addgene: 114512
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).