Expasy logo

ABCD

ABCD_AK460 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q62889 Rattus norvegicus (Rat)
UniProt: Q8BYM5 Mus musculus (Mouse)
UniProt: Q9NZ94 Homo sapiens (Human)
Target name NLGN3, NL3, Neuroligin-3, Gliotactin homolog
Epitope Intracellular C-terminal domain
Sequence:
YYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGPPHDTLRLTAL
PDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLPNSHSTTRV
Antibody information
Antibody name N110/29.4R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N110_29.pdf
Addgene: 114518
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).