Expasy logo

ABCD

ABCD_AK462 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9WUT2 Mus musculus (Mouse)
UniProt: O43497 Homo sapiens (Human)
UniProt: Q9WUT2 Mus musculus (Mouse)
Target name CACNA1G, Voltage-dependent T-type calcium channel subunit alpha-1G, Cav3.1c, NBR13, Voltage-gated calcium channel subunit alpha Cav3.1
Epitope Cytoplasmic C-terminal domain
Sequence:
QAAIRTDSLDVQGLGSREDLLSEVSGPSCPLTRSSSFWGGSSIQVQQRSGSQSKVSKHIR
LPAPCPGLEPSWAKDPQETRSSLELDTELSWISGDLLPSSQEEPLSPRDLKKCYSVEAQS
C
Antibody information
Antibody name N178A/9.1R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N178A_9.pdf
Addgene: 114520
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).