ABCD_AK464 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q92913 Homo sapiens (Human) UniProt: Q9ERW3 Rattus norvegicus (Rat) UniProt: P70377 Mus musculus (Mouse) |
| Target name | FGF13, FHF2, Fibroblast growth factor 13, FGF-13, Fibroblast growth factor homologous factor 2, FHF-2 |
| Epitope | Sequence:GSKKRRRRRPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
| Antibody information | |
| Antibody name | N91/27.1R |
| Applications | Immunofluorescence, Western blot |
| Cross-references | NeuroMab: N91_27.pdf Addgene: 114525 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |