ABCD_AK465 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9ERE9 Mus musculus (Mouse) UniProt: G3V9M2 Rattus norvegicus (Rat) |
| Target name | Mapk8ip2, Ib2, Jip2, C-Jun-amino-terminal kinase-interacting protein 2, JIP-2, JNK-interacting protein 2, Islet-brain-2, IB-2, JNK MAP kinase scaffold protein 2, Mitogen-activated protein kinase 8-interacting protein 2 |
| Epitope | Sequence:PSSDPGIEADLRSHSSGGHEGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSGRSSHLTNSIEEASSPASEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMISEGSSPIRCPGQCLSPAPRLPEEAASQANSVPQDCQDPEAGPHVELVDMDTLCGPP |
| Antibody information | |
| Antibody name | N135/37.2R |
| Applications | Immunofluorescence, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N135_37.pdf Addgene: 114527 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |