Expasy logo

ABCD

ABCD_AK472 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JKN5 Mus musculus (Mouse)
UniProt: Q9WUQ3 Rattus norvegicus (Rat)
Target name Olig1, Oligodendrocyte transcription factor 1, Oligo1, Oligodendrocyte-specific bHLH transcription factor 1, Olg-1 bHLH protein
Epitope N-terminal domain
Sequence:
MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKP
AREKAEA
Antibody information
Antibody name N149/25.1R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N149_25.pdf
Addgene: 114540
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).