ABCD_AK473 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O54982 Mus musculus (Mouse) |
| Target name | Kcnu1, Kcnma3, Ksper, Slo3, Potassium channel subfamily U member 1, Calcium-activated potassium channel subunit alpha-3, Calcium-activated potassium channel, subfamily M subunit alpha-3, Pore-forming subunit of the sperm-specific alkalization activated K(+) current, KSper, Slowpoke homolog 3, mSlo3 pH-sensitive maxi potassium channel |
| Epitope | C-terminal domain Sequence:SSPSIQAQNNSTNATTPLAQGSNFFDSHHADESHDLYPVDDTGERWSQHHHSRVYPLDTLDASDIVQEK |
| Antibody information | |
| Antibody name | N2/16R |
| Applications | Immunofluorescence, Western blot |
| Cross-references | NeuroMab: N2_16.pdf Addgene: 114541 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |