Expasy logo

ABCD

ABCD_AK475 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O75899 Homo sapiens (Human)
UniProt: Q80T41
UniProt: O88871 Rattus norvegicus (Rat)
Target name GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, GABA-B receptor 2, GABA-B-R2, GABA-BR2, GABABR2, Gb2, G-protein coupled receptor 51, HG20
Epitope Cytoplasmic C-terminal domain
Sequence:
PQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDAS
Antibody information
Antibody name N81/37.1R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N81_37.pdf
Addgene: 114544
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.