ABCD_AK478 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P50571 Mus musculus (Mouse) UniProt: P15431 Rattus norvegicus (Rat) UniProt: P18505 Homo sapiens (Human) |
| Target name | GABRB1, Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1 |
| Epitope | Cytoplasmic loop Sequence:NYIFFGKGPQKKGASKQDQSANEKNRLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDRHGVPGKGRIRRRASQLKVKIPDLTDVNSID |
| Antibody information | |
| Antibody name | N96/55.3R |
| Applications | Immunofluorescence, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N96_55.pdf Addgene: 114549 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |