Expasy logo

ABCD

ABCD_AK479 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O15327 Homo sapiens (Human)
Target name INPP4B, Inositol polyphosphate 4-phosphatase type II, Type II inositol 3,4-bisphosphate 4-phosphatase
Epitope Sequence:
TGYQFIYYSPENTAKAKEVLSNINQLQPLIATHADLLLNSASQHSPDSLKNSLKMLSEKT
ELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKSSTEESSPQDQPPVMRGQDSIPHHS
DYDE
Antibody information
Antibody name N171/17.4R
Applications Immunofluorescence, Western blot
Cross-references NeuroMab: N171_17.pdf
Addgene: 114551
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).