Expasy logo

ABCD

ABCD_AK484 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9R0N4 Mus musculus (Mouse)
UniProt: O08625 Rattus norvegicus (Rat)
Target name Syt10, Synaptotagmin-10, Synaptotagmin X, SytX
Epitope Cytoplasmic C2A domain
Sequence:
LVVKIIKALDLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPVVYD
QLSNRKLHFSIYDFDRFSRHDMIGEVIL
Antibody information
Antibody name N269/73R
Applications Immunofluorescence, Western blot
Cross-references NeuroMab: N269_73.pdf
Addgene: 114558
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).