ABCD_AK485 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q09429 Rattus norvegicus (Rat) UniProt: Q09427 Cricetus cricetus (Black-bellied hamster) UniProt: Q8BNE2 Mus musculus (Mouse) |
| Target name | Abcc8, Sur, Sur1, ATP-binding cassette sub-family C member 8, Sulfonylurea receptor 1 |
| Epitope | Cytoplasmic C-terminal domain Sequence:LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK |
| Antibody information | |
| Antibody name | N289/16R |
| Applications | Immunofluorescence, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N289_16.pdf Addgene: 114556 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |