Expasy logo

ABCD

ABCD_AK489 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q63540 Rattus norvegicus (Rat)
UniProt: P54253 Homo sapiens (Human)
UniProt: P54254 Mus musculus (Mouse)
Target name ATXN1, ATX1, SCA1, Ataxin-1, Spinocerebellar ataxia type 1 protein
Epitope Sequence:
ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP
Antibody information
Antibody name N76/3R
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N76_3.pdf
Addgene: 114559
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).