ABCD_AK489 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63540 Rattus norvegicus (Rat) UniProt: P54253 Homo sapiens (Human) UniProt: P54254 Mus musculus (Mouse) |
| Target name | ATXN1, ATX1, SCA1, Ataxin-1, Spinocerebellar ataxia type 1 protein |
| Epitope | Sequence:ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP |
| Antibody information | |
| Antibody name | N76/3R |
| Applications | Immunofluorescence, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N76_3.pdf Addgene: 114559 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |