Expasy logo

ABCD

ABCD_AK490 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9Z0U4 Rattus norvegicus (Rat)
UniProt: Q9WV18 Mus musculus (Mouse)
UniProt: Q9UBS5 Homo sapiens (Human)
Target name GABBR1, GPRC3A, Gamma-aminobutyric acid type B receptor subunit 1, GABA-B receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1
Epitope Cytoplasmic C-terminal domain
Sequence:
FSSYITLVVLFVPKMRRLITRGEWQSETQDTMKTGSSTNNNEEEKSRLLEKENRELEKII
AEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPSEPPD
Antibody information
Antibody name N93A/49
Applications Immunofluorescence, Immunohistochemistry, Western blot
Cross-references NeuroMab: N93A_49.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.