Expasy logo

ABCD

ABCD_AP902 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P05067 Homo sapiens (Human)
UniProt: P12023 Mus musculus (Mouse)
Target name APP, Amyloid beta A4 protein, Alzheimer disease amyloid protein, Beta-amyloid precursor protein, Protease nexin-II
Epitope Amyloid beta protein 42, N-terminal truncated amyloid beta peptide 3-42 (N3pGlu, N3pE, Abeta p3-42)
Sequence:
XFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Antibody information
Antibody name anti-N3pGlu-VI
Antibody synonyms anti-N3pGlu-mE8
Applications ELISA, Immunohistochemistry, Surface plasmon resonance
Publications Patent: US20140065138
PMID: 23217740
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.