ABCD_AP902 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P05067 Homo sapiens (Human) UniProt: P12023 Mus musculus (Mouse) |
| Target name | APP, Amyloid beta A4 protein, Alzheimer disease amyloid protein, Beta-amyloid precursor protein, Protease nexin-II |
| Epitope | Amyloid beta protein 42, N-terminal truncated amyloid beta peptide 3-42 (N3pGlu, N3pE, Abeta p3-42) Sequence:XFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Antibody information | |
| Antibody name | anti-N3pGlu-VI |
| Antibody synonyms | anti-N3pGlu-mE8 |
| Applications | ELISA, Immunohistochemistry, Surface plasmon resonance |
| Publications | Patent: US20140065138 PMID: 23217740 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |