Expasy logo

ABCD

ABCD_AR538 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P78536 Homo sapiens (Human)
Target name ADAM17, CSVP, TACE, CD156b, Disintegrin and metalloproteinase domain-containing protein 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme
Epitope Membrane-proximal cysteine-rich extension (ADAM17_E)
Sequence:
FCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGK
CE
Antibody information
Antibody name anti-ADAM17-A300E
Antibody synonyms A300E mAb, A300E-scFv
Applications ELISA, Flow cytometry, Immunoprecipitation, Western blot
Publications PMID: 22509934
PMID: 21726562
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).