Expasy logo

ABCD

ABCD_AU119 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P09429 Homo sapiens (Human)
UniProt: P63159 Rattus norvegicus (Rat)
Target name HMGB1, HMG1, High mobility group protein B1, High mobility group protein 1, HMG-1
Epitope Sequence:
PTGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADK
ARYEREMKTYIPPKGET
Antibody information
Antibody name anti-HMGB1-10D4
Antibody synonyms 10D4 HMGB1 mAb
Applications ELISA, Western blot
Cross-references Cellosaurus: CVCL_B4HA
Publications Patent: US20110217292
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).