ABCD_AU119 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P09429 Homo sapiens (Human) UniProt: P63159 Rattus norvegicus (Rat) |
| Target name | HMGB1, HMG1, High mobility group protein B1, High mobility group protein 1, HMG-1 |
| Epitope | Sequence:PTGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGET |
| Antibody information | |
| Antibody name | anti-HMGB1-10D4 |
| Antibody synonyms | 10D4 HMGB1 mAb |
| Applications | ELISA, Western blot |
| Cross-references | Cellosaurus: CVCL_B4HA |
| Publications | Patent: US20110217292 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |