ABCD_AU832 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P16389 Homo sapiens (Human) UniProt: P63141 Mus musculus (Mouse) UniProt: P63142 Rattus norvegicus (Rat) UniProt: P22739 Xenopus laevis (African clawed frog) UniProt: E7F8M2 Danio rerio (Zebrafish) (Brachydanio rerio) |
| Target name | KCNA2, Potassium voltage-gated channel subfamily A member 2, NGK1, Voltage-gated K(+) channel HuKIV, Voltage-gated potassium channel HBK5, Voltage-gated potassium channel subunit Kv1.2 |
| Epitope | Sequence:QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV |
| Antibody information | |
| Antibody name | K14/16R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K14_16.pdf Addgene: 128614 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |