ABCD_AU842 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q62696 Rattus norvegicus (Rat) UniProt: Q811D0 Mus musculus (Mouse) |
| Target name | Dlg1, Dlgh1, Disks large homolog 1, Synapse-associated protein 97, SAP-97, SAP97 |
| Epitope | Sequence:MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPP |
| Antibody information | |
| Antibody name | K64/15R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K64_15.pdf Addgene: 128624 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |