Expasy logo

ABCD

ABCD_AU842 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q62696 Rattus norvegicus (Rat)
UniProt: Q811D0 Mus musculus (Mouse)
Target name Dlg1, Dlgh1, Disks large homolog 1, Synapse-associated protein 97, SAP-97, SAP97
Epitope Sequence:
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTL
LDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPP
Antibody information
Antibody name K64/15R
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: K64_15.pdf
Addgene: 128624
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).