Expasy logo

ABCD

ABCD_AU844 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P19024 Rattus norvegicus (Rat)
UniProt: Q09470 Homo sapiens (Human)
UniProt: P16388 Mus musculus (Mouse)
Target name Kcna5, Potassium voltage-gated channel subfamily A member 5, RCK7, RK4, Voltage-gated potassium channel subunit Kv1.5
Epitope Sequence:
RKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRETDL

Antibody information
Antibody name K7/45R
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: K7_45.pdf
Addgene: 140069
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.