ABCD_AU844 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P19024 Rattus norvegicus (Rat) UniProt: Q09470 Homo sapiens (Human) UniProt: P16388 Mus musculus (Mouse) |
| Target name | Kcna5, Potassium voltage-gated channel subfamily A member 5, RCK7, RK4, Voltage-gated potassium channel subunit Kv1.5 |
| Epitope | Sequence:RKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRETDL |
| Antibody information | |
| Antibody name | K7/45R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K7_45.pdf Addgene: 140069 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |