ABCD_AU846 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P04774 Rattus norvegicus (Rat) UniProt: P35498 Homo sapiens (Human) UniProt: A2APX8 Mus musculus (Mouse) |
| Target name | Scn1a, Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1 |
| Epitope | Sequence:HLLKRTVKQASFTYNKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK |
| Antibody information | |
| Antibody name | K74/71R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K74_71.pdf Addgene: 128626 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |