Expasy logo

ABCD

ABCD_AU846 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P04774 Rattus norvegicus (Rat)
UniProt: P35498 Homo sapiens (Human)
UniProt: A2APX8 Mus musculus (Mouse)
Target name Scn1a, Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1
Epitope Sequence:
HLLKRTVKQASFTYNKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDR
VTKPIVEKHEQEGKDEKAKGK
Antibody information
Antibody name K74/71R
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: K74_71.pdf
Addgene: 128626
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).