ABCD_AU847 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q62897 Rattus norvegicus (Rat) UniProt: Q9UK17 Homo sapiens (Human) UniProt: Q9Z0V1 Mus musculus (Mouse) UniProt: O57662 Xenopus laevis (African clawed frog) |
| Target name | Kcnd3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3 |
| Epitope | Sequence:RADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHSGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASP |
| Antibody information | |
| Antibody name | K75/41R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: K75_41.pdf Addgene: 128627 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |