Expasy logo

ABCD

ABCD_AU847 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q62897 Rattus norvegicus (Rat)
UniProt: Q9UK17 Homo sapiens (Human)
UniProt: Q9Z0V1 Mus musculus (Mouse)
UniProt: O57662 Xenopus laevis (African clawed frog)
Target name Kcnd3, Potassium voltage-gated channel subfamily D member 3, Voltage-gated potassium channel subunit Kv4.3
Epitope Sequence:
RADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIES
QHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSP
SLSSHSGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLN
LKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASP
Antibody information
Antibody name K75/41R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: K75_41.pdf
Addgene: 128627
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).