ABCD_AU851 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9JIN6 Mus musculus (Mouse) UniProt: Q9ESK8 Rattus norvegicus (Rat) UniProt: Q86W47 Homo sapiens (Human) |
| Target name | Kcnmb4, Calcium-activated potassium channel subunit beta-4, BK channel subunit beta-4, BKbeta4, Calcium-activated potassium channel subfamily M subunit beta-4, Charybdotoxin receptor subunit beta-4, K(VCA)beta-4, Maxi K channel subunit beta-4, Slo-beta-4 |
| Epitope | Sequence:QDLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQHQLLTNPKCSYIPPCKRENQKNSESVMNWQQYWKDEIGSQPFTCYFNQHQRPEDVLLQRTHDE |
| Antibody information | |
| Antibody name | L18A/3R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: L18A_3.pdf Addgene: 149454 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |